NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206349_1782875

Scaffold Ga0206349_1782875


Overview

Basic Information
Taxon OID3300020075 Open in IMG/M
Scaffold IDGa0206349_1782875 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1291
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007126Metagenome / Metatranscriptome357Y
F029856Metagenome / Metatranscriptome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0206349_17828751F029856N/AWTDGYATAERALRRAGLGFFGLRAVLRVLSPAESDALLGVSAAASLDDDRALYRDTEWPVEQVEKFKPYSTASLYAFAREGFLSTSGKRSPA
Ga0206349_17828753F007126AGGAGMAGVVNDIEALAEFRAHLMRFNHDLAENFATIQGHWRELGEIWRDDMYRLFGEALEEVTPGIATY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.