NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206356_11125612

Scaffold Ga0206356_11125612


Overview

Basic Information
Taxon OID3300020070 Open in IMG/M
Scaffold IDGa0206356_11125612 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2211
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis algeriensis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001698Metagenome / Metatranscriptome650Y
F002850Metagenome / Metatranscriptome526Y
F004352Metagenome / Metatranscriptome442Y
F008441Metagenome / Metatranscriptome333Y

Sequences

Protein IDFamilyRBSSequence
Ga0206356_111256121F008441N/AGLLWAKVVGSSLALAGALIERGEWEDVRALAGFLAGAGEESAATELRIRLGGAVWEAHREHLRAISNNMPPAAIELAINALRAILREVPEEFPDRNREVNCFLPPLASAVYAIMRKQEAEIPYHSRVEHIATGGVAKYPDIVKTSLDELAAEFDGICRRPGGPTT
Ga0206356_111256122F001698AGGAGMAGVVNDIEALAEFRAHLMRFNHDLAENFATIQGHWRELGEIWRDDMYRLFGEALEEVTPGIATYLSATEGHEAHLAALIERLSGYLETGAGAGLGVGRPPEVRGGMAGGTGQGTARRDRNSR
Ga0206356_111256123F002850GGAVTGIHADIDALKGLHDALARYRHAQRDVTARGEDQLTATRASLETKASRLRAQLELGQAEYTACQDRAAQADPDDPVDCSGHARAVQQDFERLEQIRLWQQRIDAEAGEFSGIAGRFADLLENDLPRMEEHLVAIIASLEAARRVRAPAS
Ga0206356_111256124F004352GGAGGMISRPEQDGDQQLRLLGDAWDKAAEHWRDGPARQFGTAQLTPLLQESRSYLEALRKLMDLLETAERETEG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.