Scaffold Ga0180108_1071833

Overview

Basic Information

• Taxon OID: 3300020066
• Scaffold ID: Ga0180108_1071833
• Source Dataset Name: Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 579
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9232
  • Long. (^o): -106.9513
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052443	Metagenome / Metatranscriptome	142	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0180108_10718331	F052443	N/A	ESMFVETYRFGSDSIMLGGDARAIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATQYFDKIEVWRKENVQKDPIAVGIIGTDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYIVSPGGAMAGLAALGYLAWGLLA