Scaffold Ga0163151_10042598

Overview

Basic Information

• Taxon OID: 3300020057
• Scaffold ID: Ga0163151_10042598
• Source Dataset Name: Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3388
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat → Freshwater Microbial Mat Bacterial Communities From Lake Vanda, Mcmurdo Dry Valleys, Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Lake Vanda, McMurdo Dry Valleys
• Coordinates
  • Lat. (^o): -77.5281
  • Long. (^o): 161.59
  • Depth (m): 19

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083890	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163151_100425987	F083890	N/A	MTGPKTDAQRQADRKARETAAGRVQFKRWVHPDDVPAMHAEAERLERKRLRGLKRANDEAEPETTHDQA