Scaffold Ga0207193_1036063

Overview

Basic Information

• Taxon OID: 3300020048
• Scaffold ID: Ga0207193_1036063
• Source Dataset Name: Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Minnesota - Twin Cities
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5551
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment → Sulfate-Impacted Lake Microbial Communities From Northern Minnesota

Source Dataset Sampling Location

• Location Name: Lake Manganika, Minnesota, USA
• Coordinates
  • Lat. (^o): 47.489552
  • Long. (^o): -92.573009

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050379	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207193_10360638	F050379	AGGAG	MIEAQLQMEADDLIAKYKHEIVRDGDWWWGTDTHSFNIHSPDNDDWFNVNVYKVDPVTGMDDCTHWIDLPRVFIKGEMK