| Basic Information | |
|---|---|
| Taxon OID | 3300020048 Open in IMG/M |
| Scaffold ID | Ga0207193_1019000 Open in IMG/M |
| Source Dataset Name | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Minnesota - Twin Cities |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8765 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment → Sulfate-Impacted Lake Microbial Communities From Northern Minnesota |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Manganika, Minnesota, USA | |||||||
| Coordinates | Lat. (o) | 47.489552 | Long. (o) | -92.573009 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060911 | Metagenome | 132 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207193_10190003 | F060911 | GGA | MIPRETRELESLIKVNKHLGIALAELTTTHSYIGSLTEQRKLISVKLKVESIIERTLKAERLAKQSFFRKLK |
| ⦗Top⦘ |