Scaffold Ga0207352_1427

Overview

Basic Information

• Taxon OID: 3300020039
• Scaffold ID: Ga0207352_1427
• Source Dataset Name: Rumen fluid microbial communities from healthy moose, Palmer, Alaska- post 0.2 um filtrate Viral contigs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Ohio State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 105545
• Total Scaffold Genes: 186
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 58 (31.18%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Moose Rumen → Rumen Microbial Communities From Healthy Moose, Palmer, Alaska

Source Dataset Sampling Location

• Location Name: Palmer, Alaska
• Coordinates
  • Lat. (^o): 61.5997
  • Long. (^o): -148.1128

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053097	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207352_14279	F053097	N/A	MFDIRGDKISLNAEDLAIPPFKDHYNNAKDKSLALKEIEYIIWLYKWNTPYEAYPVDQRPKIVAKDVFKDEKYVPTAEVKELAKRFNEFQETPGTRLLSASQSAAEGLIAALNEYS