Scaffold Ga0207352_1170

Overview

Basic Information

• Taxon OID: 3300020039
• Scaffold ID: Ga0207352_1170
• Source Dataset Name: Rumen fluid microbial communities from healthy moose, Palmer, Alaska- post 0.2 um filtrate Viral contigs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Ohio State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 28379
• Total Scaffold Genes: 58
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 36 (62.07%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Moose Rumen → Rumen Microbial Communities From Healthy Moose, Palmer, Alaska

Source Dataset Sampling Location

• Location Name: Palmer, Alaska
• Coordinates
  • Lat. (^o): 61.5997
  • Long. (^o): -148.1128

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036964	Metagenome / Metatranscriptome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207352_117053	F036964	AGGAG	MNNLVDILKIVFPALMVTGALGSLIVNIFTKGDWPVSLQWFGAMLLYTALLFRNK