NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193753_10113444

Scaffold Ga0193753_10113444


Overview

Basic Information
Taxon OID3300020034 Open in IMG/M
Scaffold IDGa0193753_10113444 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1335
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9767Long. (o)-107.0044Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009625Metagenome / Metatranscriptome315Y
F020936Metagenome / Metatranscriptome221Y

Sequences

Protein IDFamilyRBSSequence
Ga0193753_101134441F020936GAGGMIEPTVRFPVVCPKCGREKLTEFPINEVVYALKGGSDITLVATCHDVIWTATEQELEQIHEYLLVLKGGSDEKI
Ga0193753_101134442F009625GGAGMPLTSFELGRLKIIGHVREELDLAGIAALSIRCIAGGIETPPGIARLTISVNGTSASLDFAAHEVEDCEVIVAGETWHKIAALINRLLS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.