Basic Information | |
---|---|
Taxon OID | 3300020027 Open in IMG/M |
Scaffold ID | Ga0193752_1228390 Open in IMG/M |
Source Dataset Name | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 692 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Yonathbacteria → Candidatus Yonathbacteria bacterium RIFCSPHIGHO2_01_FULL_51_10 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: East River, Colorado | |||||||
Coordinates | Lat. (o) | 38.9767 | Long. (o) | -107.0044 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088972 | Metagenome / Metatranscriptome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193752_12283902 | F088972 | GAG | VKNAEKVNAVKGVQVYIQTHAWQDPNGYPGGGIHERAKKLANRKPGDPNPFVDPATWDARAKRQLETAKKVLAEEQAKAGATKTN |
⦗Top⦘ |