NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193738_1000287

Scaffold Ga0193738_1000287


Overview

Basic Information
Taxon OID3300020020 Open in IMG/M
Scaffold IDGa0193738_1000287 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)31451
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (21.88%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.8827Long. (o)-106.9107Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027225Metagenome195Y
F028948Metagenome / Metatranscriptome190Y

Sequences

Protein IDFamilyRBSSequence
Ga0193738_100028712F028948GAGMEKSQEFLKREFIHLLSDTLALLGAEKRLIEDLKASEENPFSLKTIEKIRRYNREQKDKTKDAAALLNTTFSYPSN
Ga0193738_100028720F027225N/ALFAICFFFVFVSCKQSEEKKELWAPIIDFFSPDLTYYPGIKKFPFPDSLRFVSLESFFSNQDKKPILSDSTIIFFDNYRVNGQKLCCKKDTLELFIDSIKGKKYLFVIGEYISVLQSHNNPDTNLRVRKNLGSIPLWGIQLNVPYPVTKFKGQYEKLGAKFVEIDPRSDEVSRQKWNENDSILVETIQFNNSTDRYITSVHKDMNENEMNSIIEQLKNKFPTITYEEAIQKSSDGKPLKVIRMYFQGISISFNQNEENVYSFMITDYYETLKLIINNAGVGYVFTDDIKIY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.