| Basic Information | |
|---|---|
| Taxon OID | 3300020014 Open in IMG/M |
| Scaffold ID | Ga0182044_1076170 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1321 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Algavirales → Phycodnaviridae → environmental samples → Organic Lake phycodnavirus 2 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 31.972 | Long. (o) | -81.028 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027780 | Metagenome / Metatranscriptome | 193 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182044_10761701 | F027780 | N/A | MLSLWAVPIGARTFQQKYNAKQIPHVTLLENLKPEKKAHEFFPPTLNLKVQSNEMVVRKMKDKYEYGWVFTHEGGDLFMTCHEVDKNEIPAVNIKKLDVNELDTVVVYSIDGVLVDPSDLDTAWAYDSDENWL |
| ⦗Top⦘ |