NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193739_1016985

Scaffold Ga0193739_1016985


Overview

Basic Information
Taxon OID3300020003 Open in IMG/M
Scaffold IDGa0193739_1016985 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1896
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.8827Long. (o)-106.9107Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001947Metagenome / Metatranscriptome613Y
F076050Metagenome / Metatranscriptome118Y
F081014Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0193739_10169851F076050GGCGGMTEGDDRLVDRDGFAGSLGESPRALPDPGGLFATLQRVIDATRVVFQVDGASLALEHEDGSLRWVVVTDGAAGLLEDTQRE
Ga0193739_10169852F081014AGGAGVGSFTGSSRELPDQPIPTVDPEVERLAHVVVDGLIARLALEPAVPASSLLDSLAGQLEQAAALHRLGVVRRTTGD
Ga0193739_10169853F001947GGAMDKGRRCTCWPKPDDARPCTPQTCDWRCRACVVHGRPFYSHGDLQYLEHGTGPMAAELDRLWRAKGTMKGGTTRQGARHDIDGWRTPPRGAAGLPPPRGSRTVTDLYYPGLQDPPPGHDGRNAGSGQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.