NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193718_1003065

Scaffold Ga0193718_1003065


Overview

Basic Information
Taxon OID3300019999 Open in IMG/M
Scaffold IDGa0193718_1003065 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3549
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9362Long. (o)-106.9425Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012927Metagenome / Metatranscriptome276Y
F015272Metagenome / Metatranscriptome256Y
F096106Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0193718_10030651F012927GAGGMTAYVFLLVILALISASAAYFFLGRLSRFPCRTIRDVPAFLQPVDSAGMMQLLNPQTEEFLHSAMTGLALRLEQRRSLHFMREHLLRLSHNAHILLEWSNAELKREIVGQSEEDSECYRDCARQLHTAAIELKLYATLSLIKINLWLAFRTQSWLPLSPPSLSALGQIGGLRF
Ga0193718_10030652F015272AGGVDIALGLFPPFLQTWLTFLLVRRGAYKSFPFFLTYTVFAVVAELCKFAVAQYSQHTLTLRYFYFYWGAEAIYAVLGFLAIHEVFRRVFESFNSLPWFKFLLPLVGLGMLTISILISIVHRAVETGPLLEGIYSLQIAVRCLQIGVFFLIFFLARAFELDYRQYAFGIAVGFGIASAGILLGTLVRTGLGLKSLIFFQYGPIVAYCIAVTVWLVSFLRAEPEDPFRDFRHMFTPEMFLGQLKRYKQEVRGIFKP
Ga0193718_10030653F096106GAGMVGIDWKYFLRTALPLAALTDVLTMILHPLAFFVLLPANLVWAISRYQRRRPIPIRSGQGARTGALMGLLSFAFFLAFFLVTVSFQHGQYRDIMVSRIHEIAAQNPDPQAQQMLQWFATPAGLVTFTSIALVTIFLICLVIGTGSGAVVVALGKGRKRP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.