Scaffold Ga0193711_1000081

Overview

Basic Information

• Taxon OID: 3300019997
• Scaffold ID: Ga0193711_1000081
• Source Dataset Name: Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 17336
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (61.11%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9825
  • Long. (^o): -107.0101
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056451	Metagenome	137	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193711_10000813	F056451	N/A	VHKIRTIVILAMLLVGAIAALYYGVRWFGRELRDKPYVANVKTQLRSLAAAEEAYRRDSLAYTSEVARVWHPSAETQGIEIGILEAGADGFLAEGRHDAWAGRCVIAVGRSAGDSLPVGEPVCHWGRD