| Basic Information | |
|---|---|
| Taxon OID | 3300019888 Open in IMG/M |
| Scaffold ID | Ga0193751_1014731 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4003 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: East River, Colorado | |||||||
| Coordinates | Lat. (o) | 38.8924 | Long. (o) | -106.9111 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006709 | Metagenome | 366 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193751_10147313 | F006709 | GGGGG | MKIAGFFLLLAGGALVLTAVALLALSLPRTGFVLAGVSVEVIGIVLVARSHLLEQGDRG |
| ⦗Top⦘ |