NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193729_1000013

Scaffold Ga0193729_1000013


Overview

Basic Information
Taxon OID3300019887 Open in IMG/M
Scaffold IDGa0193729_1000013 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)95639
Total Scaffold Genes103 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)63 (61.17%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9225Long. (o)-106.9538Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004145Metagenome / Metatranscriptome451Y
F005900Metagenome / Metatranscriptome387Y
F028608Metagenome / Metatranscriptome191Y

Sequences

Protein IDFamilyRBSSequence
Ga0193729_100001343F004145GGCGGMGYAILLDGERVAHMSTGEEVSAWITKYREDHATDDPSAVHLQILERGTLAWLTGGKLIDRERFS
Ga0193729_100001354F028608AGGMMDALGLLGMFLFCSMVIALAAGITWVVVRLSPSKKPS
Ga0193729_100001387F005900GGAGGMTADEIRLTLPADDAFHSVAHLVLGGLAARLNLSFENLEDLELALDALLERPSDGREVTVRVLVEDGKLRTIVGPFVAVRAELQEGGAGSLNLGRILSAVCDSVEIEDRDGSQWVVLTKRLDVLKEGRA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.