NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193704_1052313

Scaffold Ga0193704_1052313


Overview

Basic Information
Taxon OID3300019867 Open in IMG/M
Scaffold IDGa0193704_1052313 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)797
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9203Long. (o)-106.9495Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029832Metagenome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0193704_10523131F029832N/AIPIYFLITYGAYSLFCSIYTINSDMLRAAFSGLFAVFVGLVSAYQVNNYFHYEKDTIYGGKNDAAMVMYNEFLKPYMAGHPNSRILYHEFGPFDEWSYVVVRWLGGKRVQTMRDEGKLVFLTNGNRASIDRLLKEGYFDIVVSAHPDQLEHMLPDTKAMGAKISPPWYKVYYVKR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.