| Basic Information | |
|---|---|
| Taxon OID | 3300019861 Open in IMG/M |
| Scaffold ID | Ga0206388_1080075 Open in IMG/M |
| Source Dataset Name | Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA - DGG1A 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Toronto |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11196 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (58.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. F21 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From Methanogenic Benzene-Degrading Culture |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oklahoma | |||||||
| Coordinates | Lat. (o) | 36.0 | Long. (o) | -97.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010068 | Metagenome / Metatranscriptome | 309 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0206388_10800752 | F010068 | N/A | MGIRRRFCMNIKGTYYVLTKSAMTTAFGEERWKSFMTKLAEKDKYFKNMIMSVTLSPVEKLIIFFDEMCAEFFNNDRMSYLMFGKIGAKYALTSEGPYKAFMLTKDIKQFVEVYMPKLWTAFFDGGTVITKLENNTVHLKVTGINIKNLYFEQLVLGYNQQALKVYGKKSVVKKVRSIASGDADIYFRFELMEA |
| ⦗Top⦘ |