Scaffold Ga0206388_1003360

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0206388_1003360

Scaffold Ga0206388_1003360

Overview

Basic Information
Taxon OID	3300019861 Open in IMG/M
Scaffold ID	Ga0206388_1003360 Open in IMG/M
Source Dataset Name	Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA - DGG1A 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Toronto
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	30844
Total Scaffold Genes	43 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	37 (86.05%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From Methanogenic Benzene-Degrading Culture

Source Dataset Sampling Location
Location Name	USA: Oklahoma
Coordinates	Lat. (^o)	36.0	Long. (^o)	-97.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048390	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0206388_100336042	F048390	AGTAG	MVRFVRTLQHRITPQGRDFYALSIPPQVAEALELKDGGQVSICVNPVKKGKFEITLKPASSDNINP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.