| Basic Information | |
|---|---|
| Taxon OID | 3300019767 Open in IMG/M |
| Scaffold ID | Ga0190267_10139288 Open in IMG/M |
| Source Dataset Name | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1041 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Arizona | |||||||
| Coordinates | Lat. (o) | 35.0244 | Long. (o) | -111.7363 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002570 | Metagenome / Metatranscriptome | 547 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0190267_101392881 | F002570 | AGGAG | MKTRLTVTLLTLTGLIILAGQLRGGSSAATVDNNVNPHYKGGSAFNLAGAAPNVPRCGAFPQNVELSFTGSGIDTEGGYNTAVFSACTDTSTNLVFDLKATDTYAQTGDQVFIEGDPFVLVPNPAICAAANAHGVPFRVTGGTGGHAGATGTGRFHIAS |
| ⦗Top⦘ |