Scaffold Ga0194023_1034538

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0194023_1034538

Scaffold Ga0194023_1034538

Overview

Basic Information
Taxon OID	3300019756 Open in IMG/M
Scaffold ID	Ga0194023_1034538 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1022
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location Name	USA: Delaware
Coordinates	Lat. (^o)	38.7906	Long. (^o)	-75.1638	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047576	Metagenome	149	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0194023_10345382	F047576	N/A	MTIQKILTFNFLDEKISVDYDFKNTISIYSLDNFNNRDYAPLERIFDKKLNQNNIENQILEYLKKFDYVKQDYKTLDNGIETTYKREIFKRVK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.