NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194000_1052690

Scaffold Ga0194000_1052690


Overview

Basic Information
Taxon OID3300019750 Open in IMG/M
Scaffold IDGa0194000_1052690 Open in IMG/M
Source Dataset NameSediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)618
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012964Metagenome275Y
F075993Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0194000_10526901F012964N/AFFWLDANVWEKVFATMEEQVPPSQSPAMAQITPEQLEAMKARARELALQQTIAQQAAAPREQPQVVYVRRNLTVAEILVVLAISCGIVTGIQGAWHIATNVLPRIEIKVR
Ga0194000_10526902F075993N/AVANRRISEFPAISGIDVNEQDLLTLVHVFEVDPTLRNKKITFTEFRNYLDQYYVNITGEIIAGDITITGNLTVSGHTSL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.