Scaffold Ga0194002_1037436

Overview

Basic Information

• Taxon OID: 3300019745
• Scaffold ID: Ga0194002_1037436
• Source Dataset Name: Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 724
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: USA: Delaware
• Coordinates
  • Lat. (^o): 38.7906
  • Long. (^o): -75.1638
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090274	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194002_10374362	F090274	N/A	MGSDSIQVATSKEDWDDFFAEWDDPQDAIDSMDSYADRVRVACELSGRQIQKANQRLDESTQEKIRVTIEFEFDR