NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194013_1004568

Scaffold Ga0194013_1004568


Overview

Basic Information
Taxon OID3300019733 Open in IMG/M
Scaffold IDGa0194013_1004568 Open in IMG/M
Source Dataset NameSediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_9-10_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1170
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001166Metagenome / Metatranscriptome760Y
F006847Metagenome / Metatranscriptome363N
F034161Metagenome / Metatranscriptome175N

Sequences

Protein IDFamilyRBSSequence
Ga0194013_10045681F006847AGAAGGMGELLMLFITGGGSTAMGAILKGVFGYIFEAKQNKHDLEMAREARASDNFLRLQAEIAKGGTGEFVSFTRRILAVIGVSTLCACIILCTLFPTAEIVTLTNADGEGANEFFFGLISFQANQEPITISSGHISLMGCTVILPCILGFYFGPSGRRG
Ga0194013_10045682F001166AGGMFKNMATEIGDNVQVKANLAFMAKVIAIVGTCVWGYSVVWNKLMVLDSSLDRVQHEGTLLGDLSARMMHLEKFAEQSKVDLNHLLEMQDAPITSDHQQFERLKYLEKELDRLRDKVEGMR
Ga0194013_10045683F034161N/AFRSMQELARAQSDPRYKSGDKAYHEEIDRRLQVSSI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.