Scaffold Ga0194001_1000265

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0194001_1000265

Scaffold Ga0194001_1000265

Overview

Basic Information
Taxon OID	3300019730 Open in IMG/M
Scaffold ID	Ga0194001_1000265 Open in IMG/M
Source Dataset Name	Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3901
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location Name	USA: Delaware
Coordinates	Lat. (^o)	38.7906	Long. (^o)	-75.1638	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024116	Metagenome / Metatranscriptome	207	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194001_10002651	F024116	N/A	NWKDYISIILFLIIVLGGLVLLGSCDGGWSIAGYEV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.