NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193981_1019020

Scaffold Ga0193981_1019020


Overview

Basic Information
Taxon OID3300019705 Open in IMG/M
Scaffold IDGa0193981_1019020 Open in IMG/M
Source Dataset NameSediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_2-3_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)748
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090407Metagenome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0193981_10190201F090407GGAGGMVLDNTLIGVLILILGGILVLGYFNWSNTRDARRHTQKIFQQQRLVREVPDAHRLSQAVHLLRPSVRLGFDYFIETEDGKLPHISEWNTAGTMPTQAEFDEALRRVGSIDSKGYAAMRRQEYPSIEEQLDAAFKARHGDTSEQEELDSRIEQIKSKYPKS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.