Scaffold Ga0193997_1019033

Overview

Basic Information

• Taxon OID: 3300019702
• Scaffold ID: Ga0193997_1019033
• Source Dataset Name: Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_3-4_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 733
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: USA: Delaware
• Coordinates
  • Lat. (^o): 38.7906
  • Long. (^o): -75.1638
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022857	Metagenome	212	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193997_10190333	F022857	N/A	VIGSLLTSMDAITVPKLTVSFAVDLELDYDSFGGKTPEEIAASLQDEMDDLLFEASSSVVGVYTSITAINSDD