Scaffold Ga0187893_10008920

Overview

Basic Information

• Taxon OID: 3300019487
• Scaffold ID: Ga0187893_10008920
• Source Dataset Name: White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 15633
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: USA: the Island of Hawaii
• Coordinates
  • Lat. (^o): 19.0643
  • Long. (^o): -155.8008

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029045	Metagenome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187893_100089202	F029045	AGG	MAILKFEPAKECNFLRVKIARDVQERVGRYRAFCGALELADLVERALVYVMDKDADFRAQEKEGAAIPAKGAQRWSVKWVSPADKTGAP