Scaffold Ga0187901_10208407

Overview

Basic Information

• Taxon OID: 3300019378
• Scaffold ID: Ga0187901_10208407
• Source Dataset Name: Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Alfalfa, Gen0, Rep 2, Chloramphenicol
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1678
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium Contig4 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.4148
  • Long. (^o): -119.8405
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075508	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187901_102084072	F075508	AGGA	MREITIMASDEKNPIHEQHIYDYFTVTEKFVRTAVPQLVADYLDQFREKLVVEFETYFNGQKMHHDDIARAVADIVEKSIGSAIHNLKISI