Scaffold Ga0187894_10000974

Overview

Basic Information

• Taxon OID: 3300019360
• Scaffold ID: Ga0187894_10000974
• Source Dataset Name: White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 37926
• Total Scaffold Genes: 40
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 24 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: USA: Hawaii
• Coordinates
  • Lat. (^o): 19.2894
  • Long. (^o): -155.8119

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020202	Metagenome / Metatranscriptome	225	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187894_1000097413	F020202	GGAG	VSRDPVRDLPILTDVVELHATGSFPKPERVPESEAPYAAGLLSEEDVASLQAMLVNRTLNLTDELLHAAARDIEAVMFERVIDRLRAALPDLVAAALREQLAPGED