Scaffold Ga0173481_10028653

Overview

Basic Information

• Taxon OID: 3300019356
• Scaffold ID: Ga0173481_10028653
• Source Dataset Name: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1766
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.3
  • Long. (^o): -89.38
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048347	Metagenome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0173481_100286532	F048347	N/A	MKYYNKVFDIFLYEGVFIFLFSLLLLLLNDIYTEIFFKVSISSIITAGVLWITGHLFNLFVKEDTFEES