Scaffold Ga0182077_1285364

Overview

Basic Information

• Taxon OID: 3300019281
• Scaffold ID: Ga0182077_1285364
• Source Dataset Name: Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 548
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 31.972
  • Long. (^o): -81.028
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018734	Metagenome / Metatranscriptome	233	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0182077_12853642	F018734	N/A	MIGLGCQLIEGELEEIKINALGYTENGRAILDSQEHIFTEAFAEMEVLSAEDKLS