Scaffold Ga0184642_1532582

Overview

Basic Information

• Taxon OID: 3300019279
• Scaffold ID: Ga0184642_1532582
• Source Dataset Name: Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 867
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9195
  • Long. (^o): -106.9496

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052479	Metagenome / Metatranscriptome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0184642_15325821	F052479	GGAGG	MLAEKKKMSLADIEAQSAFELPDREMMLVTIVITNLLNNLSVDVDVKNVNVAVQVCAVVAALNTNIATSLTCDIQ