NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184644_1373355

Scaffold Ga0184644_1373355


Overview

Basic Information
Taxon OID3300019269 Open in IMG/M
Scaffold IDGa0184644_1373355 Open in IMG/M
Source Dataset NameMetatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1220
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022154Metagenome / Metatranscriptome215Y
F091473Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0184644_13733551F091473AGGAGMKKVLLLMVAVLMVSSVAMADHIGVYADGTGASCGLGAAGSFNPNAAVIHKFTVGATGSRFKVVFPPGTSFFGFNSPFVPVGQLNSDISLGYGQCLSGNIVLGTINAIYGAGVGSVTAADLQPIILYTDCSFGEYPATGGTFYVGTTGPCNEVATE
Ga0184644_13733552F022154AGGAGMKKALAGVLAVALVGVIAGSAMAQVPNIQVYFDSALSQTQRECGQQGTVDSLFVVMNNWNMNVTGVDFSISYPPSLIWLGDNLPDPSTSQKIGNSPTGIAIAYANCCFLNGFVANDVLHPIFLWGPCDCSQGPKSIVVGGYTPSGKTQPTAVRKEDFQEFSGVGLTSLICPGAIATEPSTWGQVKALYR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.