| Basic Information | |
|---|---|
| Taxon OID | 3300019252 Open in IMG/M |
| Scaffold ID | Ga0172286_1087105 Open in IMG/M |
| Source Dataset Name | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 751 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Ohio | |||||||
| Coordinates | Lat. (o) | 41.3778 | Long. (o) | -82.5111 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016975 | Metagenome / Metatranscriptome | 243 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0172286_10871051 | F016975 | GGA | VSPPGSQAGAAITSRSELRGLTQYSSDRKALDGPAMRPHTPLAVENSVGKLAAIQGA |
| ⦗Top⦘ |