Scaffold Ga0184648_1523377

Overview

Basic Information

• Taxon OID: 3300019249
• Scaffold ID: Ga0184648_1523377
• Source Dataset Name: Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 590
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → unclassified Hoeflea → Hoeflea sp. WL0058 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9195
  • Long. (^o): -106.9496

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067220	Metagenome / Metatranscriptome	126	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0184648_15233771	F067220	N/A	FMKNDVHSFEWNAGKKEYEVALDKGNQRKRAIETHDYLNELHKYSPEASTYNWGELMSTYFTEKAASSWYVGSRLLDQTIANNPKIADATLPFELPKKVTDAYYLSIQGFHILEKSNVEGAKKYVTFFMKHPDVISWYHAVPLHIIPASREMLHSAKYQDNPVIQKRMDVLKFLDSVWTKGVPLYYWDGKELNQHI