Scaffold Ga0172287_1437682

Overview

Basic Information

• Taxon OID: 3300019246
• Scaffold ID: Ga0172287_1437682
• Source Dataset Name: Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1361
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location

• Location Name: USA: Ohio
• Coordinates
  • Lat. (^o): 41.3778
  • Long. (^o): -82.5111
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016481	Metagenome / Metatranscriptome	247	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172287_14376823	F016481	GAGG	MKEEMEGQEEWWKHISEDKKKAFIKAKLEFKIKKVQAKLDFLKELQKIFG