Scaffold Ga0172287_1365396

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0172287_1365396

Scaffold Ga0172287_1365396

Overview

Basic Information
Taxon OID	3300019246 Open in IMG/M
Scaffold ID	Ga0172287_1365396 Open in IMG/M
Source Dataset Name	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	837
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location
Location Name	USA: Ohio
Coordinates	Lat. (^o)	41.3778	Long. (^o)	-82.5111	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105212	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172287_13653961	F105212	N/A	NGGSGQEFLSELEVKSYGSQDPRHRWVGVQDHKEQSDDVRTA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.