Basic Information | |
---|---|
Taxon OID | 3300019241 Open in IMG/M |
Scaffold ID | Ga0187793_1229229 Open in IMG/M |
Source Dataset Name | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 610 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Colombia: Department of Meta | |||||||
Coordinates | Lat. (o) | 4.0627 | Long. (o) | -73.195 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F098815 | Metagenome / Metatranscriptome | 103 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0187793_12292291 | F098815 | N/A | MRGQSLARSVVETLPACSPLRLLSRIGSVRPSPLAFFLPARSHRLGTAFRLPFGSPATTVLFREPPWRGQSSWPIPSASIPNLSSSPFGLELPPSMTLFTPPGAFLAQNPLPAGKPETLKRPSNFRSPSGFSSLRIRALGQRLNLRSLPLCSARFSFAPRRR |
⦗Top⦘ |