Scaffold Ga0180116_1092651

Overview

Basic Information

• Taxon OID: 3300019229
• Scaffold ID: Ga0180116_1092651
• Source Dataset Name: Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 548
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9228
  • Long. (^o): -106.9513
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038727	Metagenome / Metatranscriptome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180116_10926512	F038727	N/A	GSGFTLQTGLGLARFAGTMYLSMFAGPMMMARLNAFGAANLGGMGMLGNPTLYQMQVGGLGGFGRGAGIDGTAGAASYLMQQAMTMNSLGGFVGTPGQGPSYDESLGEAVQNAAKAVQKALQK