NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0179936_1061876

Scaffold Ga0179936_1061876


Overview

Basic Information
Taxon OID3300019220 Open in IMG/M
Scaffold IDGa0179936_1061876 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC059_MetaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)591
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA: Illinois
CoordinatesLat. (o)41.53Long. (o)-90.43Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021262Metagenome / Metatranscriptome219N
F049316Metagenome / Metatranscriptome147N

Sequences

Protein IDFamilyRBSSequence
Ga0179936_10618761F049316AGGAGGMDKDKRITTIVLDKEADRKSKIIAEFTGKSVARVYRNALDAYFEHFINNELFSAINSYFAKLYYQYDIDNPKIYDAIQSGNFADAAVMIAEAIKQLPQEPEAQKLIDEGMR
Ga0179936_10618762F021262N/ASKEMSKRYYVKLTTGKELTGTAKEIVTQLRNESRLMAISPRKYAKLVAKSYKMSTGLKLRTWTYNSFVKSLGKSLMVMEFKEVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.