Scaffold Ga0180037_1130859

Overview

Basic Information

• Taxon OID: 3300019214
• Scaffold ID: Ga0180037_1130859
• Source Dataset Name: Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 883
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 46.234
  • Long. (^o): -123.91
  • Depth (m): 9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103311	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0180037_11308591	F103311	N/A	MFDSIIIMFLPFLLGFTGTMLLSNIFLSKFNDLKLQGTYSSRVKKKTIFKNAGSLVLFFGGSVSLCFIVVLGFVPPPMFMKVLLLGGVLVAIGFKTGGFVFTPKVLFFITLLFAIILVALLQPLYLKTLGVFGFIIGVVFSFGCVYILKFLNLLDRTAVLFSISVTLFGSVLGVYTDDIILSAGNFSVMGSLLAFSYFNFSESRRIELGTTGELLIGLAIAAQGLYFFDKQATDYFNFIPFAFLIFLYPISDALQYFGTIAINKIFRIKIKVCQIHEHFSSTNMP