NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180037_1110022

Scaffold Ga0180037_1110022


Overview

Basic Information
Taxon OID3300019214 Open in IMG/M
Scaffold IDGa0180037_1110022 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7844
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.234Long. (o)-123.91Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004712Metagenome / Metatranscriptome427Y
F042922Metagenome / Metatranscriptome157N
F066802Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0180037_11100221F066802N/ATKVEGLANIFYETQLYNDTKYLPVLIEPDYAYSSVTFTDAQNIIGQRREGLQKDTVRHVNSAYNFIDVNLTRRDARNLLTAVYNDFAYDKFNPGVAAPTYADNGSQNAVRTFTASFFNYDGTHVFPVFNPADSTLGLKYKGSVNSVADLSTITGQKPKWSYIVATDYATNFYAGDIYYWNGSAWVGAGTNNTDLLDAFAGAWTRMKTYINTNLSPDLEHENMVTGLFDDCLLDNILRPETLIFGSLVESIAHQFNGASAGVNRNALPLNFRNLGQAISAIASVLNEDGGRIRWSGADELNNQYFARGLRINGRTGRIEGRPFTSSVRKLARRASNSRAVV
Ga0180037_11100222F004712GGAMSDPILVTTSQAPDAKPIAVNKILTTTPAVIVDVPQYRVPELVFGGSTTVEPGVGEIISPLILCNVTASTVTVNVRVFRWADAGGAGLYYFILKNFPVPAGDTIPIPLNGQFLGTGDKLEVDCSVDFAIHSTLSFTLGQAEEDDVV
Ga0180037_11100224F042922AGGMASRANIYIDKGLDFRTEINLFNDAGEEYDDATISVYSFYSSIKKVYSSAAAANFTVEVANNDITLVLTDQQTDLLTPGKYQYDVVMQKQTGERTKIVEGLAIVVDTITEVS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.