Scaffold Ga0179950_1073068

Overview

Basic Information

• Taxon OID: 3300019213
• Scaffold ID: Ga0179950_1073068
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW2_MetaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 586
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan: Saitama Prefecture
• Coordinates
  • Lat. (^o): 35.92
  • Long. (^o): 139.63
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006059	Metagenome / Metatranscriptome	382	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0179950_10730682	F006059	N/A	DYLAIKKERYVMLMHLQFSPVLASAVWIGGGGVGLLLVIVVVVLLLRR