Basic Information | |
---|---|
Taxon OID | 3300019201 Open in IMG/M |
Scaffold ID | Ga0180032_1118116 Open in IMG/M |
Source Dataset Name | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 694 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus turicensis | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Washington | |||||||
Coordinates | Lat. (o) | 46.183 | Long. (o) | -123.19 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F017444 | Metagenome / Metatranscriptome | 240 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0180032_11181162 | F017444 | N/A | LFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY |
⦗Top⦘ |