Scaffold Ga0180033_108696

Overview

Basic Information

• Taxon OID: 3300019198
• Scaffold ID: Ga0180033_108696
• Source Dataset Name: Estuarine microbial communities from the Columbia River estuary - R8.48AS metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3081
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 46.232
  • Long. (^o): -123.89
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080526	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180033_1086962	F080526	AGGAGG	MPNPLLPIAGAVVGVGTGTMISESALMTPKAIGLFYVGIAKTCYTSTGSKRIACAVAALACGTALIPGPHQGPFIVACAAASRGADKL