| Basic Information | |
|---|---|
| Taxon OID | 3300019192 Open in IMG/M |
| Scaffold ID | Ga0184603_134753 Open in IMG/M |
| Source Dataset Name | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 725 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Czech Republic: South Bohemian Region | |||||||
| Coordinates | Lat. (o) | 49.0431 | Long. (o) | 13.617 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005081 | Metagenome / Metatranscriptome | 412 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0184603_1347531 | F005081 | N/A | ADGHKRGVSLALVSTQSIHDLLSRSTYPDTGSWVLAQQWFLSQIGQASHRPCKNAWIRSFSTGSYPSMADCTILTITCDEPFLKLLRKALHEQVGCGNPMIVASTIDEACSLLPMAHPRLIVVHWNRQGGRSEELNRLLWATTVLARGVPVLVIADRYRVDQATTFYRMGVADYISRTHHEGQLGRVLDTYLRHRPAASPPDPASPDDPIQSVKAWSANTQPLKAHVM |
| ⦗Top⦘ |