Scaffold Ga0184585_152575

Overview

Basic Information

• Taxon OID: 3300019189
• Scaffold ID: Ga0184585_152575
• Source Dataset Name: Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 766
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.0431
  • Long. (^o): 13.617

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009200	Metagenome / Metatranscriptome	321	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0184585_1525753	F009200	N/A	VKLFQIEEPEGGPADPTVPGAAVGVDVSGAGAEVAISVGGNAAVLADREGFEQALAVPDLAAAADE