Scaffold Ga0194244_10105386

Overview

Basic Information

• Taxon OID: 3300019150
• Scaffold ID: Ga0194244_10105386
• Source Dataset Name: Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 536
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030978	Metatranscriptome	183	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0194244_101053861	F030978	N/A	NGLVVRTKTQIANLTRKVEQFNVKICSIGGPGVCSGGGYLKDMLDLNTELIGYLSSITDNVNVRDLFDFLTICYCEYDHFFKDHRHQITGHHQQRTVLLPLAYDIVFNEIKGILDFITNNTVNYTM